Technology Catalogue models
- Anti CB1 (mouse) Monoclonal Antibody
- Anti-Insulin (mouse) Monoclonal Antibody
- Anti CB1 (rabbit) Polyclonal Antibody
- Anti NOX5 (mouse) Monoclonal Antibody
- (mouse) Monoclonal Antibody
Anti CB1 (mouse) Monoclonal Antibody
Concentration: 1.0 mg/mL
Physical State: Liquid
Size: 50μg
The cannabinoid receptor type 1 is a guanine-nucleotide-binding protein (G-protein)-coupled cannabinoid receptor primarily located in the central and peripheral nervous system. It is activated by endo-cannabinoid neurotransmitters; by plant cannabinoids including THC, an active ingredient of the psychoactive drug cannabis and by synthetic analogues of THC. Two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene.
Gene Name |
Cannabinoid Receptor 1 |
Gene ID |
NCBI Reference Sequence: NM_007726.3 |
Family |
GPCR, Cannabinoid |
Synonyms |
CB1; CNR1 Antibody; CB-R Antibody; CB1A Antibody; CB1R Antibody; CANN6 Antibody; CB1K5 Antibody |
Host |
Mouse |
Clonality |
Monoclonal |
Clone ID |
IMG-3C2 |
Isotype |
IgG1 |
Immunogen |
This monoclonal antibody was produced by repeated immunizations with a synthetic peptide corresponding to amino acid residues 443-473. |
Mouse |
MHRAAESCIKSTVKIAKVTMSVSTDTSAEAL |
Human |
VHRAAESCIKSTVKIAKVTMSVSTDTSAEAL |
Species Reactivity |
Mouse, Human (and with species that show high homology, although not tested) |
Buffer |
0.02M Potassium Phosphate, 0.15M Sodium Chloride pH 7.2 |
Stabilizer |
10mg/mL Bovine Serum Albumin (BSA) – Immunoglobulin and Protease free |
Preservative |
0.01% (w/v) Sodium Azide |
Storage Condition |
For extended storage aliquot contents and freeze at -20°C or below. Avoid repeated freeze-thaw cycles. Centrifuge product if not completely clear after standing at room temperature. This product is stable for several weeks at 4° C as an undiluted liquid. Dilute only prior to immediate use. |
Application Note |
This monoclonal antibody is suitable for Immunohistochemistry (IHC) (paraffin embedded (IHC-P) or fresh frozen (IHC-F) tissue specimen and western blot. Expect a ~52.8kDa single band corresponding to the CB1 protein by western blot when analyzing appropriate cell lysates or extracts. This CB1 monoclonal antibody specifically reacts with mouse and human CB1, while cross-reactivity with CB1 protein originating from different species and/or other sources has not been determined. Specific conditions for reactivity should be optimized by the end user. |
Purity / Specificity |
This product was purified from concentrated tissue culture supernatant by Protein G chromatography and specifically reacts with human CB1 protein. |
Assay Dilution |
User Optimized Immunocytochemistry (ICC) 100 ng/ml |
Figure 1: FcRn TG mouse anti-CB1 monoclonal antibody IMG-3C2 reacts to a highly conserved C-terminal 31-mer oligopeptide of the mouse cannabinoid receptor type 1 (CB1R) that is identical to its human ortholog as shown by immunofluorescence using the antibody at 1 μg/ml. (Figure is reproduced with permission from Dr István Katona, Institute of Experimental Medicine, Hungarian Academy of Sciences).
Laboratory Reagent For In Vitro Research Use Only
Not for resale without prior written consent from ImmunoGenes AG.
Anti-Insulin (mouse) Monoclonal Antibody
Human insulin (INS) monoclonal antibody may be used for the analysis of the structure, function and metabolism of insulin. This anti-insulin antibody, is applicable for immune-histological studies of tissue sections.
Antigenic specificity |
Insulin (INS) |
Host |
Mouse |
Clonality |
IMG-7B2, Monoclonal (IgG2a kappa) |
Concentration, package size |
1 mg/ml (liquid), 100 μg |
Immunogen |
This monoclonal antibody was produced by repeated immunizations with a KLH-conjugated synthetic peptide corresponding to the C-terminal part of human insulin chain B |
Species Reactivity |
Human, Rat (and other species that show high homology, although not tested) |
Buffer |
0.02M Potassium Phosphate, 0.15M Sodium Chloride pH 7.2 |
Stabilizer |
10 mg/ml Bovine Serum Albumin (BSA) – Immunoglobulin and Protease free |
Preservative |
0.01% (w/v) Sodium Azide |
Storage Condition |
For extended storage aliquot contents and freeze at -20°C or below. Avoid repeated freeze-thaw cycles. Centrifuge product if not completely clear after standing at room temperature. This product is stable for several weeks at 4° C as an undiluted liquid. Dilute only prior to immediate use. |
Application Note |
This monoclonal antibiotic is suitable for Immunohistochemistry (IHC) (paraffin embedded (IHC-P) or fresh frozen (IHC-F) tissue specimen and ELISA. Specific conditions for reactivity should be optimized by the end user. |
Purity / Specificity |
This product was purified from concentrated tissue culture supernatant by Protein G chromatography and specifically reacts with human insulin protein. |
Assay Dilution |
Immunocytochemistry (ICC) 1:100 Immunohistochemistry (IHC) 1:100 Other assays user optimized |
Anti CB1 (rabbit) Polyclonal Antibody
Concentration: 1.0 μg/mL
Physical State: Liquid
Size: 50μg
The cannabinoid receptor type 1 is a guanine-nucleotide-binding protein (G-protein)-coupled cannabinoid receptor primarily located in the central and peripheral nervous system. It is activated by endo-cannabinoid neurotransmitters; by plant cannabinoids including THC, an active ingredient of the psychoactive drug cannabis and by synthetic analogues of THC. Two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene.
Gene Name |
Cannabinoid Receptor 1 |
Gene ID |
NCBI Reference Sequence: NM_007726.3 |
Family |
GPCR, Cannabinoid |
Synonyms |
CB1; CNR1 Antibody; CB-R Antibody; CB1A Antibody; CB1R Antibody; CANN6 Antibody; CB1K5 Antibody |
Host |
Rabbit |
Clonality |
Polyclonal |
Immunogen |
This polyclonal antibody was produced by repeated immunizations with a synthetic peptide corresponding to amino acid residues 443-473. |
Mouse |
MHRAAESCIKSTVKIAKVTMSVSTDTSAEAL |
Human |
VHRAAESCIKSTVKIAKVTMSVSTDTSAEAL |
Species Reactivity |
Mouse, Human (and with species that show high homology, although not tested) |
Buffer |
0.02M Potassium Phosphate, 0.15M Sodium Chloride pH 7.2 |
Stabilizer |
10mg/mL Bovine Serum Albumin (BSA) – Immunoglobulin and Protease free |
Preservative |
0.01% (w/v) Sodium Azide |
Storage Condition |
For extended storage aliquot contents and freeze at -20°C or below. Avoid repeated freeze-thaw cycles. Centrifuge product if not completely clear after standing at room temperature. This product is stable for several weeks at 4° C as an undiluted liquid. Dilute only prior to immediate use. |
Application Note |
This polyclonal antibody is suitable for Immunohistochemistry (IHC) (paraffin embedded (IHC-P) or fresh frozen (IHC-F) tissue specimen and western blot. Expect a ~52.8kDa single band corresponding to the CB1 protein by western blot when analyzing appropriate cell lysates or extracts. This CB1 polyclonal antibody specifically reacts with mouse and human CB1, while cross-reactivity with CB1 protein originating from different species and/or other sources has notbeen determined. Specific conditions for reactivity should be optimized by the end user. |
Purity / Specificity |
This product was purified from rabbit serum by peptide immunoaffinity chromatography and specifically reacts with human CB1 protein. |
Assay Dilution |
User Optimized Immunocytochemistry (ICC) 1 μg/ml |
Reference |
Dudok et al. 2014. Cell-Specific STORM Super-Resolution Imaging Reveals Nanoscale Organization Of Cannabinoid Signaling. Nat Neurosci 2014 Dec 8. Doi: 10.1038/Nn.3892 |
Laboratory Reagent For In Vitro Research Use Only
Not for resale without prior written consent from ImmunoGenes AG.
Figure 1: Immunostaining with the affinity purified anti-CB1 (rabbit) polyclonal antibody developed by ImmunoGenes against CB1 receptor labels axon terminals of hippocampal interneurons. (a) Confocal image showing the biocytin-labeled axon and axon terminals of an interneuron recorded in acute brain slice. (b) Subsequent STORM super-resolution imaging revealed CB1R immunolabeling on the identified axon terminals. (c) Magnified view of the STORM localization points from the boxed region in b depicts the nanoscale distribution of CB1 receptors. (Reference: Dudok et al. 2014. Cell-Specific STORM Super-Resolution Imaging Reveals Nanoscale Organization Of Cannabinoid Signaling. Nat Neurosci 2014 Dec 8. Doi: 10.1038/Nn.3892).
Anti NOX5 (mouse) Monoclonal Antibody
Concentration: 1.0 mg/mL
Physical State: Liquid
Size: 50μg
NOX5 is the calcium dependent NADPH oxidase-5 that generates superoxide, and functions as a calcium-dependent proton channel that may regulate redox-dependent processes in lymphocytes and spermatozoa. This protein is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes.
Gene Name |
NADPH oxidase 5 |
Gene ID |
NCBI 79400 |
Host |
Mouse |
Clonality |
Monoclonal |
Clone ID |
IMG-1E10 |
Immunogen |
This monoclonal antibody was produced by repeated immunizations with a recombinant human NOX5-GST protein. The immunogen was the first 167 AA of the human NOX5 protein (β isoform): MSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESFFAERFFALFDSDRSGTITLQELQEALTLL IHGSPMDKLKFLFQVYDIDGSGSIDPDELRTVLQSCLRESAISLPDEKLDQLTLALFESADADGNGAITFEEL RDELQRFPGVMENLTISAAHWLT |
Species Reactivity |
Human (and with species that show high homology, although not tested) |
Buffer |
0.02M Potassium Phosphate, 0.15M Sodium Chloride pH 7.2 |
Stabilizer |
10mg/mL Bovine Serum Albumin (BSA) – Immunoglobulin and Protease free |
Preservative |
0.01% (w/v) Sodium Azide |
Storage Condition |
For extended storage aliquot contents and freeze at -20°C or below. Avoid repeated freeze-thaw cycles. Centrifuge product if not completely clear after standing at room temperature. This product is stable for several weeks at 4° C as an undiluted liquid. Dilute only prior to immediate use. |
Application Note |
This monoclonal antibody is suitable for Immunohistochemistry (IHC) (paraffin embedded (IHC-P) tissue specimen, western blot and ELISA. Expect a ~70kDa single band corresponding to the NOX5 protein by western blot when analyzing appropriate cell lysates or extracts. Specific conditions for reactivity should be optimized by the end user. |
Purity / Specificity |
This product was purified from concentrated tissue culture supernatant by Protein G chromatography and specifically reacts with human NOX5 protein. |
Assay Dilution |
User Optimized |
Laboratory Reagent For In Vitro Research Use Only
Not for resale without prior written consent from ImmunoGenes AG.
Reference: Petheő et al. 2021. Disruption of the NOX5 Gene Aggravates Atherosclerosis in Rabbits. Circulation Research. 2021;128:1320–1322.
Anti DUOX 1 (mouse) Monoclonal Antibody
Concentration: 1.0 mg/mL
Physical State: Liquid
Size: 50μg
The dual oxidase 1 protein is a member of the NADPH oxidase family. This protein is known as dual oxidase because it has both a peroxidase homology domain and a gp91phox homologous domain. This protein generates hydrogen peroxide and probably plays a role in antimicrobial defense at mucosal surfaces.
Gene Name |
Dual oxidase 1 |
Gene ID |
NCBI 53905 |
Host |
Mouse |
Clonality |
Monoclonal |
Clone ID |
IMG-8A1 |
Isotype |
Not tested |
Immunogen |
This monoclonal antibody was produced by repeated immunizations with a recombinant human Duox1-HIS protein, which contains the 622-1032 AA residues of the whole Duox1 protein. |
Species Reactivity |
Human and mouse (and with species that show high homology, although not tested) |
Buffer |
0.02M Potassium Phosphate, 0.15M Sodium Chloride pH 7.2 |
Stabilizer |
10mg/mL Bovine Serum Albumin (BSA) – Immunoglobulin and Protease free |
Preservative |
0.01% (w/v) Sodium Azide |
Storage Condition |
For extended storage aliquot contents and freeze at -20°C or below. Avoid repeated freeze-thaw cycles. Centrifuge product if not completely clear after standing at room temperature. This product is stable for several weeks at 4° C as an undiluted liquid. Dilute only prior to immediate use. |
Application Note |
This monoclonal antibody is suitable for western blot and ELISA. It was able to recognize the antigen in HaCaT cell lines as well. The specificity was tested on knock out samples. Specific conditions for reactivity should be optimized by the end user. |
Purity / Specificity |
This product was purified from concentrated tissue culture supernatant by Protein G chromatography and specifically reacts with human and mouse DUOX1 protein. |
Assay Dilution |
User Optimized |
Laboratory Reagent For In Vitro Research Use Only
Not for resale without prior written consent from ImmunoGenes AG.